DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and plscr2

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_012818771.1 Gene:plscr2 / 100489273 XenbaseID:XB-GENE-5819744 Length:283 Species:Xenopus tropicalis


Alignment Length:295 Identity:161/295 - (54%)
Similarity:193/295 - (65%) Gaps:27/295 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 GQPHYGGGAPPPQ--AFGGYPPGPAGPGGPPNAFGGYPPG----QPQQPIVTQPGMGPGMGPGMA 174
            |.|..|.|.|..|  |:.||||       ..|.:|..|||    ||.|.:.||||:     ||.|
 Frog     6 GNPGLGYGNPEFQNAAYPGYPP-------QQNPYGYPPPGPYQFQPGQAMPTQPGV-----PGAA 58

  Fly   175 PQGGPAGDWMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYF 239
                    ||.||...||||.|||||:.|||:||.|:|||||..||||||||:.|||:|||:|||
 Frog    59 --------WMPIPAANPNCPPGLEYLSQIDQILVHQQVELLEVLTGFETNNKYEIKNSLGQRVYF 115

  Fly   240 AAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQSIEVSAPPGNVIGTI 304
            |||:|||||||.|||:|||.|.:.||..:||:.:||||.||:|.||||||.:||.||||.|:|.:
 Frog   116 AAEENDCCTRNYCGPSRPFAMTIVDNTGREVMKLHRPLRCSACCFPCCLQKLEVQAPPGTVVGYV 180

  Fly   305 EQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVSL-TGEKIGKISKQWSGLAREIF 368
            .|.|..|.|.|.|.:.....|::|.||......|.||.|.|:|: ....:|:|||||:|..:|||
 Frog   181 VQNWHPCLPKFTIQDEREQGVLKISGPCIPCRCCTDVNFEVMSVDESSVVGRISKQWAGSVKEIF 245

  Fly   369 TDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403
            ||.|.|||.||:|||::.|||||||.||||.||||
 Frog   246 TDTDNFGIQFPMDLDIKTKAVLLGACFLIDFMFFE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887 6/14 (43%)
Scramblase 184..404 CDD:252175 134/221 (61%)
plscr2XP_012818771.1 Scramblase 60..280 CDD:252175 132/219 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 289 1.000 Domainoid score I1540
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H41418
Inparanoid 1 1.050 327 1.000 Inparanoid score I2430
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - mtm9553
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1891
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.