DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and LOC100489081

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_031755478.1 Gene:LOC100489081 / 100489081 -ID:- Length:237 Species:Xenopus tropicalis


Alignment Length:273 Identity:72/273 - (26%)
Similarity:116/273 - (42%) Gaps:64/273 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PPG--PAGPGGPPNAFGGYPPGQPQQPIVTQPGMGPGMGPGMAPQGGPAGDWMSIPTGIPNCPRG 196
            |||  ...|..||:.   |||       |.|.....|..||.                       
 Frog    13 PPGYNTIAPYAPPDQ---YPP-------VAQHLATTGASPGS----------------------- 44

  Fly   197 LEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMR 261
             |.|..|:||.:::|.::.:.:     ...|.:.|:.||:::.|.:     :.:.|||.  .|:.
 Frog    45 -ELLAQINQLSIREKFKVSQGW-----GRSFDVLNSDGQRIFQAEQ-----SAHFCGPV--LDVN 96

  Fly   262 VFDNFQQEVIHMHRPLACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVM 326
            :.||...||:.......||      |.:.:||..|.|..:|.:...|:.......|:|....||:
 Frog    97 IRDNSGNEVMEFIDTCKCS------CSREMEVYWPRGFPVGYVTLHWNQMVTHMSIMNSAKQTVL 155

  Fly   327 RIEGPFCTFSLCGDVEFNVVSLTGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLL 391
            .|.||.....:.|:..|.|.|...:.:       .|:.|.   :.:.|.::|||||:|.:|||||
 Frog   156 LIIGPSFRSGIFGNSCFEVKSTDEQHV-------VGVIRH---ENESFSVSFPLDLEVAIKAVLL 210

  Fly   392 GATFLIDAMFFEK 404
            ||:|.:||:.:::
 Frog   211 GASFYLDAIIYQQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 58/219 (26%)
LOC100489081XP_031755478.1 LOR 38..217 CDD:413170 59/230 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23248
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.