DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and plscr4

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:XP_002942920.2 Gene:plscr4 / 100488434 XenbaseID:XB-GENE-6449820 Length:205 Species:Xenopus tropicalis


Alignment Length:217 Identity:68/217 - (31%)
Similarity:108/217 - (49%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 GIPNCPRGLEYLTTIDQLLVKQKVELLEAFTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCG 253
            |.|..|.|||.|..:|::.:||     ...:.|:.:..:.:....|..:|.|.|     ||.|||
 Frog     3 GTPVIPPGLENLLQMDEIWIKQ-----TRHSTFQNHCTYDLLTPSGALLYRAEE-----TRECCG 57

  Fly   254 PARPFDMRVFDNFQQEVIHMHRPLACSSCLFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRIL 318
            |.  ||:.|.:...|:|:.:..|  .|.|.:...||   |.:..|.::|.|.:.|:  |.:|.||
 Frog    58 PR--FDVSVQNLHGQQVLSLLLP--SSYCTWETQLQ---VFSGTGTLLGYINKTWA--SMNFTIL 113

  Fly   319 NHVGDTVMRIEGPFCTFSLCGDVEFNVVSLTGE--KIGKISKQWSGLAREIFTDADFFGINFPLD 381
            ....:..:.::||........||.|. |::.|.  ..|.|::.|.|:.:|.|:..|::.|.||.|
 Frog   114 TPTREKSLEVQGPGWGGGFMSDVNFQ-VTMYGSHAAFGLITRVWRGVKKEFFSPNDYYAIKFPRD 177

  Fly   382 LDVRMKAVLLGATFLIDAMFFE 403
            |||.:||:|:..|..||..::|
 Frog   178 LDVNVKALLVACTIYIDFTYYE 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 68/217 (31%)
plscr4XP_002942920.2 LOR 8..199 CDD:413170 65/210 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.