DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment scramb1 and si:ch211-71m22.1

DIOPT Version :9

Sequence 1:NP_648389.3 Gene:scramb1 / 326186 FlyBaseID:FBgn0052056 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001121867.1 Gene:si:ch211-71m22.1 / 100149582 ZFINID:ZDB-GENE-070705-193 Length:263 Species:Danio rerio


Alignment Length:252 Identity:137/252 - (54%)
Similarity:168/252 - (66%) Gaps:6/252 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 PIVTQPGM-----GPGMGPGMAPQGGPAGDWMSIPTGIPNCPRGLEYLTTIDQLLVKQKVELLEA 217
            |:..||..     .||.|.|.|..|......|.:|.....||.||||||.||||||:|||||.|.
Zfish     9 PVELQPNKNAIHPAPGYGQGAAIPGHGQVVMMPVPQRPDGCPPGLEYLTQIDQLLVQQKVELAEV 73

  Fly   218 FTGFETNNKFTIKNALGQKVYFAAEDNDCCTRNCCGPARPFDMRVFDNFQQEVIHMHRPLACSSC 282
            ..|:|||||:.:||::||:|::.||:||||.|..|||.|.|.:.|.||..|||:.:.|||.|.||
Zfish    74 ILGWETNNKYIVKNSMGQQVFYVAEENDCCNRQFCGPLRSFVIHVQDNLGQEVMRLMRPLKCGSC 138

  Fly   283 LFPCCLQSIEVSAPPGNVIGTIEQEWSICSPSFRILNHVGDTVMRIEGPFCTFSLCGDVEFNVVS 347
            ..|||||.:|:.:|||..||.:.|.|....|.|.|.|...:.|::||||||:...|.||.|:|:|
Zfish   139 FCPCCLQELEIQSPPGYPIGYVIQNWHPFLPKFTIQNEKKEAVLKIEGPFCSCRCCSDVNFDVLS 203

  Fly   348 L-TGEKIGKISKQWSGLAREIFTDADFFGINFPLDLDVRMKAVLLGATFLIDAMFFE 403
            | ...|:|||||||:||.||.|||||.|||:||:||||::||||.||.||||.||||
Zfish   204 LDESTKVGKISKQWTGLVREAFTDADNFGISFPMDLDVKIKAVLFGACFLIDFMFFE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
scramb1NP_648389.3 Sox_C_TAD <61..>129 CDD:288887
Scramblase 184..404 CDD:252175 128/221 (58%)
si:ch211-71m22.1NP_001121867.1 Scramblase 40..260 CDD:252175 126/219 (58%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 288 1.000 Domainoid score I1533
eggNOG 1 0.900 - - E1_KOG0621
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1015148at2759
OrthoFinder 1 1.000 - - FOG0000205
OrthoInspector 1 1.000 - - otm25733
orthoMCL 1 0.900 - - OOG6_100156
Panther 1 1.100 - - LDO PTHR23248
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1891
SonicParanoid 1 1.000 - - X164
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.