DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and LPXN

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001137467.1 Gene:LPXN / 9404 HGNCID:14061 Length:391 Species:Homo sapiens


Alignment Length:168 Identity:64/168 - (38%)
Similarity:100/168 - (59%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKK 71
            |..||:.|..::|.|||::||||||:|.||.|:|..:.|..:||...|...:.:.::..||.|..
Human   157 CASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAA 221

  Fly    72 PILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDS 136
            |||:|.:.||.::||.:.|.| ..|.:....:.|:|:|.||||:||:..:|:.:|..|.:|:.::
Human   222 PILDKVLTAMNQTWHPEHFFC-SHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLEN 285

  Fly   137 AVLAMNVKWHRDCFRCNKCENPI-TSQTFTIDGDKPVC 173
            .:.||:..||.:||.|..|.... |...|.:|| :|.|
Human   286 YLSAMDTVWHPECFVCGDCFTSFSTGSFFELDG-RPFC 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 23/50 (46%)
LIM 66..118 CDD:295319 22/51 (43%)
LIM 126..176 CDD:259829 17/49 (35%)
LPXNNP_001137467.1 LIM1_Leupaxin 155..209 CDD:188790 23/51 (45%)
LIM2_Leupaxin 216..267 CDD:188792 22/51 (43%)
LIM3_Leupaxin 275..327 CDD:188794 17/49 (35%)
LIM4_Paxillin_like 334..385 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.