DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and PXL1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_013016.4 Gene:PXL1 / 853965 SGDID:S000001798 Length:706 Species:Saccharomyces cerevisiae


Alignment Length:130 Identity:35/130 - (26%)
Similarity:53/130 - (40%) Gaps:8/130 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 FNVQSGEPVCNKCFVERYTYTCAGCKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERD 109
            |....||..|..|.:|     ..|  |.:..|....:...||.:||.|.....|...:...|...
Yeast   547 FKYPPGEGPCRACGLE-----VTG--KRMFSKKENELSGQWHRECFKCIECGIKFNKHVPCYILG 604

  Fly   110 GKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNV-KWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            .:|||:|.|.:...:.|..|...|....:....| ::|.||..|..|:..||:..:..:|:.|:|
Yeast   605 DEPYCQKHYHEENHSICKVCSNFIEGECLENDKVERFHVDCLNCFLCKTAITNDYYIFNGEIPLC 669

  Fly   174  173
            Yeast   670  669

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 4/12 (33%)
LIM 66..118 CDD:295319 14/51 (27%)
LIM 126..176 CDD:259829 14/49 (29%)
PXL1NP_013016.4 LIM1_UF1 556..614 CDD:188783 17/64 (27%)
LIM 621..672 CDD:259829 14/49 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.