DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and LRG1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_010041.2 Gene:LRG1 / 851358 SGDID:S000002399 Length:1017 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:47/196 - (23%)
Similarity:79/196 - (40%) Gaps:28/196 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAI------TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQ---SGEPV--CNKCFV 59
            :|.:|.:.:      ||..:.||||.:|...|.|..|.:.:....|..|   :.|.:  |...:.
Yeast    27 ICARCNKLVIPDSQRTKTTLKALGKYYHESCFTCQDCQKPLKPKYFPYQVDKTSESILLCQYDYF 91

  Fly    60 ERYTYTCAGCKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAA 124
            .|:...|..|..|:......|.|..:.|:.|.| ..|..|...:..:....:.|||..:...|:.
Yeast    92 RRHNLLCHVCDTPLRGLYYTAFGYRYDEEHFSC-TICATPCGVKKCFMYGNQLYCKYHFLKYFSK 155

  Fly   125 RCAKCEKPITDSAVLAMNVK----WHRDCFRCNKCEN-PITSQTFTI-----------DGDKPVC 173
            ||..||.||:|..:.....:    ||.:|:..:|..: .:.::|..:           .|||.:.
Yeast   156 RCKGCEFPISDQYIEFPKGEEIHCWHPECYGIHKYWHVNLAAETVGLQYLPKLEYNPNSGDKDIN 220

  Fly   174 P 174
            |
Yeast   221 P 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 16/61 (26%)
LIM 66..118 CDD:295319 13/51 (25%)
LIM 126..176 CDD:259829 15/65 (23%)
LRG1NP_010041.2 LIM1_Lrg1p_like 28..90 CDD:188777 16/61 (26%)
LIM 98..149 CDD:259829 13/51 (25%)
LIM3_Lrg1p_like 419..475 CDD:188779
RhoGAP_fLRG1 728..959 CDD:239862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.