Sequence 1: | NP_001286122.1 | Gene: | CG31988 / 326182 | FlyBaseID: | FBgn0051988 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010041.2 | Gene: | LRG1 / 851358 | SGDID: | S000002399 | Length: | 1017 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 196 | Identity: | 47/196 - (23%) |
---|---|---|---|
Similarity: | 79/196 - (40%) | Gaps: | 28/196 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VCHKCQEAI------TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQ---SGEPV--CNKCFV 59
Fly 60 ERYTYTCAGCKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAA 124
Fly 125 RCAKCEKPITDSAVLAMNVK----WHRDCFRCNKCEN-PITSQTFTI-----------DGDKPVC 173
Fly 174 P 174 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31988 | NP_001286122.1 | LIM | 7..58 | CDD:295319 | 16/61 (26%) |
LIM | 66..118 | CDD:295319 | 13/51 (25%) | ||
LIM | 126..176 | CDD:259829 | 15/65 (23%) | ||
LRG1 | NP_010041.2 | LIM1_Lrg1p_like | 28..90 | CDD:188777 | 16/61 (26%) |
LIM | 98..149 | CDD:259829 | 13/51 (25%) | ||
LIM3_Lrg1p_like | 419..475 | CDD:188779 | |||
RhoGAP_fLRG1 | 728..959 | CDD:239862 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1703 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.900 |