DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Tgfb1i1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006230411.1 Gene:Tgfb1i1 / 84574 RGDID:620173 Length:473 Species:Rattus norvegicus


Alignment Length:168 Identity:66/168 - (39%)
Similarity:103/168 - (61%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|.:.|..:::||||:.||||||||..|...:..::|..:.|.|.|.:|:.||::..|..|.
  Rat   239 LCGSCNKPIAGQVVTALGRAWHPEHFLCRGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCN 303

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            :||..|.:.|:|..||.:.||| .:|.:|...:.|:||:|:|||::|:..|||.||..|:.||.|
  Rat   304 QPIRHKMVTALGTHWHPEHFCC-VSCGEPFGEEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILD 367

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            :.:.|::..||.|||.|.:|..|.:..:|.....:|:|
  Rat   368 NYISALSALWHPDCFVCRECLAPFSGGSFFEHEGRPLC 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 20/50 (40%)
LIM 66..118 CDD:295319 21/51 (41%)
LIM 126..176 CDD:259829 17/48 (35%)
Tgfb1i1XP_006230411.1 Paxillin <69..>118 CDD:281527
LIM1_Paxillin_like 240..292 CDD:259830 21/51 (41%)
LIM2_Paxillin_like 299..350 CDD:188723 21/51 (41%)
LIM3_Paxillin 358..410 CDD:188793 17/48 (35%)
LIM4_Leupaxin 417..468 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.