DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and PLIM2b

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_171683.1 Gene:PLIM2b / 839267 AraportID:AT1G01780 Length:205 Species:Arabidopsis thaliana


Alignment Length:154 Identity:36/154 - (23%)
Similarity:57/154 - (37%) Gaps:41/154 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERY-------- 62
            |:.|.:.: ...|::..|..:|...|.|.||...:..:.::...|...|...|.:.:        
plant    10 CNVCDKTVYVVDMLSIEGMPYHKSCFRCTHCKGTLQMSNYSSMDGVLYCKTHFEQLFKESGNFSK 74

  Fly    63 ------------TYT--------------CAGCKKPI--LEKTICAMGESWHEDCF-CCGGACKK 98
                        |.|              ||.|:|.:  ||| |...||.:|:.|| |..|.|  
plant    75 NFQPGKTEKPELTRTPSKISSIFCGTQDKCAACEKTVYPLEK-IQMEGECFHKTCFRCAHGGC-- 136

  Fly    99 PLANQTFYERDGKPYCKKDYEDLF 122
            .|.:.::...|...||:..:..||
plant   137 TLTHSSYASLDSVLYCRHHFNQLF 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 11/51 (22%)
LIM 66..118 CDD:295319 20/54 (37%)
LIM 126..176 CDD:259829
PLIM2bNP_171683.1 LIM1_SF3 6..68 CDD:188824 12/57 (21%)
LIM 104..164 CDD:413332 22/60 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.