DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and AT4G36860

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001328324.1 Gene:AT4G36860 / 829839 AraportID:AT4G36860 Length:577 Species:Arabidopsis thaliana


Alignment Length:175 Identity:39/175 - (22%)
Similarity:60/175 - (34%) Gaps:52/175 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITK-RMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            :|..||..|.. |.::.:|..||||.|.|:.||:.|:|..|::....|....|:.|::...|..|
plant   213 ICVGCQAEIGHGRFLSCMGGVWHPECFCCNACDKPIIDYEFSMSGNRPYHKLCYKEQHHPKCDVC 277

  Fly    70 KKPILEKTICAMGESWHEDCFCCGGACKKPLANQTF---YERDGKPYCKKDYEDLFAARCAKCEK 131
            ...|.......:....|            |...|.:   :||||.|            ||..||:
plant   278 HNFIPTNPAGLIEYRAH------------PFWMQKYCPSHERDGTP------------RCCSCER 318

  Fly   132 PITDSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
                                    ..|..::...:|..:.:|..|
plant   319 ------------------------MEPKDTKYLILDDGRKLCLEC 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829 6/49 (12%)
LIM 7..58 CDD:413332 18/51 (35%)
LIM 66..118 CDD:413332 11/54 (20%)
AT4G36860NP_001328324.1 LIM_DA1 214..266 CDD:188782 18/51 (35%)
DA1-like 363..573 CDD:463530
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.