Sequence 1: | NP_001286122.1 | Gene: | CG31988 / 326182 | FlyBaseID: | FBgn0051988 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_180413.2 | Gene: | AT2G28460 / 817394 | AraportID: | AT2G28460 | Length: | 720 | Species: | Arabidopsis thaliana |
Alignment Length: | 238 | Identity: | 47/238 - (19%) |
---|---|---|---|
Similarity: | 71/238 - (29%) | Gaps: | 92/238 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 VCHK-CQEAITKRMITALGKTW-------HPEHFLCHHCDEQILDATFNVQSG------------ 50
Fly 51 ------------EPVCNKCFVERY---TYTCAGC---------------KKPILEKTICAMG--- 82
Fly 83 ---ESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVK 144
Fly 145 WHR----------DCFRCNKCENPITSQTFT-IDGDKPVCPAC 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31988 | NP_001286122.1 | LIM | 7..58 | CDD:295319 | 12/82 (15%) |
LIM | 66..118 | CDD:295319 | 17/72 (24%) | ||
LIM | 126..176 | CDD:259829 | 13/60 (22%) | ||
AT2G28460 | NP_180413.2 | C1_3 | 243..271 | CDD:284959 | |
C1_3 | 298..327 | CDD:284959 | |||
C1_2 | 353..384 | CDD:281148 | 5/13 (38%) | ||
C1_3 | 442..471 | CDD:284959 | 6/28 (21%) | ||
C1_2 | 610..639 | CDD:281148 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1593918at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |