DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and AT2G28460

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_180413.2 Gene:AT2G28460 / 817394 AraportID:AT2G28460 Length:720 Species:Arabidopsis thaliana


Alignment Length:238 Identity:47/238 - (19%)
Similarity:71/238 - (29%) Gaps:92/238 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHK-CQEAITKRMITALGKTW-------HPEHFLCHHCDEQILDATFNVQSG------------ 50
            ||.| |..|...:..|. ...|       .||..     :|::|.....:..|            
plant   370 VCTKGCSYAAHSKCATQ-SNVWDGIELEGEPEDI-----EEEVLPPFLEISDGIIQHFSHQQHHM 428

  Fly    51 ------------EPVCNKCFVERY---TYTCAGC---------------KKPILEKTICAMG--- 82
                        ...|..|....|   .|:|..|               ..||....:..:|   
plant   429 KLDENTGRDYDENKECEACIRPIYFGNFYSCLECDFILHEECANLSRKIHHPIHPHLLNLIGGFD 493

  Fly    83 ---ESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVK 144
               ..:::.|..|.|.||    ...||| .||..||    .:...:||...:|:...:       
plant   494 GVINYYNDKCSACIGLCK----GGFFYE-CGKQGCK----FMLHVQCATTSEPLVHES------- 542

  Fly   145 WHR----------DCFRCNKCENPITSQTFT-IDGDKPVCPAC 176
             ||          :..||:.|::  :.:||. |:.|..:|..|
plant   543 -HRHPLFLTSKPGEKIRCSVCKD--SEETFNCIECDFALCFYC 582

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 12/82 (15%)
LIM 66..118 CDD:295319 17/72 (24%)
LIM 126..176 CDD:259829 13/60 (22%)
AT2G28460NP_180413.2 C1_3 243..271 CDD:284959
C1_3 298..327 CDD:284959
C1_2 353..384 CDD:281148 5/13 (38%)
C1_3 442..471 CDD:284959 6/28 (21%)
C1_2 610..639 CDD:281148
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.