DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and TGFB1I1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001035919.1 Gene:TGFB1I1 / 7041 HGNCID:11767 Length:461 Species:Homo sapiens


Alignment Length:168 Identity:65/168 - (38%)
Similarity:104/168 - (61%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|.:.|..:::||||:.||||||:|..|...:..::|..:.|.|.|.:|:.||::..|..|.
Human   227 LCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCN 291

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            :||..|.:.|:|..||.:.||| .:|.:|..::.|:||:|:|||::|:..|||.||..|:.||.|
Human   292 QPIRHKMVTALGTHWHPEHFCC-VSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILD 355

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            :.:.|::..||.|||.|.:|..|.:..:|.....:|:|
Human   356 NYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLC 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 19/50 (38%)
LIM 66..118 CDD:295319 21/51 (41%)
LIM 126..176 CDD:259829 17/48 (35%)
TGFB1I1NP_001035919.1 Interaction with PTK2B/PYK2 1..240 3/12 (25%)
Transcription activation. /evidence=ECO:0000250 1..200
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..87
LD motif 1 3..15
Interaction with PTK2/FAK1. /evidence=ECO:0000250 83..136
Paxillin <86..>106 CDD:308898
LD motif 2 92..104
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..152
LD motif 3 157..168
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..205
LD motif 4 203..215
LIM1_Paxillin_like 228..280 CDD:259830 20/51 (39%)
LIM2_Paxillin_like 287..338 CDD:188723 21/51 (41%)
LIM3_Paxillin 346..398 CDD:188793 17/48 (35%)
LIM4_Leupaxin 405..456 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149723
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.