DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Pdlim7

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001107560.1 Gene:Pdlim7 / 67399 MGIID:1914649 Length:457 Species:Mus musculus


Alignment Length:170 Identity:65/170 - (38%)
Similarity:93/170 - (54%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            |||:|.:.|..|.:.|||..:|||.|:|..|.:.:.:..|..:.|...|..|:..||...||.||
Mouse   281 VCHQCHKIIRGRYLVALGHAYHPEEFVCSQCGKVLEEGGFFEEKGAIFCPSCYDVRYAPNCAKCK 345

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPIT- 134
            |.|..:.:.|:..:||..||.| .|||.|:.|:.||..:|.|||::|||.:|..:|..|:..|. 
Mouse   346 KKITGEIMHALKMTWHVHCFTC-AACKTPIRNRAFYMEEGAPYCERDYEKMFGTKCRGCDFKIDA 409

  Fly   135 -DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|:..:..:||....|||:|
Mouse   410 GDRFLEALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLC 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 17/50 (34%)
LIM 66..118 CDD:295319 23/51 (45%)
LIM 126..176 CDD:259829 17/50 (34%)
Pdlim7NP_001107560.1 PDZ_signaling 5..79 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 82..166
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 185..226
LIM1_Enigma 282..333 CDD:188836 17/50 (34%)
LIM2_Enigma 341..392 CDD:188840 23/51 (45%)
LIM3_Enigma 400..454 CDD:188842 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.