DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31988 and pdlim7

DIOPT Version :9

Sequence 1:	NP_001286122.1	Gene:	CG31988 / 326182	FlyBaseID:	FBgn0051988	Length:	178	Species:	Drosophila melanogaster
Sequence 2:	NP_001025639.1	Gene:	pdlim7 / 595027	XenbaseID:	XB-GENE-5860425	Length:	191	Species:	Xenopus tropicalis

Alignment Length:	46	Identity:	9/46 - (19%)
Similarity:	13/46 - (28%)	Gaps:	17/46 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 VQSGEPVCNKCFVERYTYTCAGCKKPILEKTICAMGESWHEDCFCC 92
            :|:||....:....|||..                 ..||.:...|
Frog   157 LQNGEKFITELQSPRYTRL-----------------RDWHHERSAC 185

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31988	NP_001286122.1	LIM	7..58	CDD:295319	3/10 (30%)
		LIM	66..118	CDD:295319	3/27 (11%)
		LIM	126..176	CDD:259829
pdlim7	NP_001025639.1	PDZ_signaling	3..81	CDD:238492
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000055
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X39
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.000