DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Fhl5

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001342427.1 Gene:Fhl5 / 57756 MGIID:1913192 Length:284 Species:Mus musculus


Alignment Length:177 Identity:56/177 - (31%)
Similarity:82/177 - (46%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQI-LDATFNVQSGEPVCNKCFVERYTYTCAG 68
            |..|:..|.  .|.:...|..||...|:|.||.:.| .....:.:||. .|..||.:.:.:.|..
Mouse   102 CFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGN-YCVPCFEKEFAHYCNF 165

  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133
            |||.|....|....:.||::||.|.| |:|.|..:.|..:|..|:|...|..|:|.:||.|.|||
Mouse   166 CKKVITSGGITFRDQIWHKECFLCSG-CRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPI 229

  Fly   134 TD----SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
            |.    ..:...:.:||.:||.|.||...:..:.|.....:.:|..|
Mouse   230 TGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTHNMEILCRKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/53 (28%)
LIM 66..118 CDD:295319 19/51 (37%)
LIM 126..176 CDD:259829 16/53 (30%)
Fhl5NP_001342427.1 LIM <3..34 CDD:413332
LIM1_FHL 37..95 CDD:188729
LIM2_FHL5 102..155 CDD:188812 15/53 (28%)
LIM 163..214 CDD:413332 19/51 (37%)
LIM4_FHL 222..277 CDD:188733 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
44.010

Return to query results.
Submit another query.