DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and fhl3a

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_021322623.1 Gene:fhl3a / 567097 ZFINID:ZDB-GENE-030131-4741 Length:279 Species:Danio rerio


Alignment Length:174 Identity:53/174 - (30%)
Similarity:84/174 - (48%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:|:|.|  ..|.:....:.:|...|.|..||..:.|..|..|....:||.|:...::..|..|
Zfish    40 CDECKELIGHDSRELFYEDRHYHEHCFRCFRCDRSLADEPFTSQDDALLCNDCYCNEFSSKCVAC 104

  Fly    70 KKPILEKT--ICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKP 132
            .|.::..|  :...|.:|||.||.| .:|::|:.:::|.......||...||:.||.||.:|::.
Zfish   105 DKTVMPGTRKLEYAGSTWHEGCFIC-NSCQQPIGSKSFIPDKDDHYCVPCYENKFAPRCTRCKQA 168

  Fly   133 ITDSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
            :....|...:..||::||.|..|:..:..|.||...|.|.|..|
Zfish   169 LAKGGVTYRDEPWHKECFVCTSCKVQLAGQHFTSRDDSPYCIKC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/52 (29%)
LIM 66..118 CDD:295319 16/53 (30%)
LIM 126..176 CDD:259829 15/49 (31%)
fhl3aXP_021322623.1 LIM <5..33 CDD:295319
LIM1_FHL3 36..94 CDD:188807 16/53 (30%)
LIM2_FHL3 98..155 CDD:188811 16/57 (28%)
LIM3_FHL 162..213 CDD:188732 16/51 (31%)
LIM4_FHL3 221..276 CDD:188818
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.