DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and pxnb

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_021334029.1 Gene:pxnb / 565130 ZFINID:ZDB-GENE-130530-697 Length:1197 Species:Danio rerio


Alignment Length:168 Identity:63/168 - (37%)
Similarity:98/168 - (58%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            ||..|.:.|..:::||:|:|||||||:|.||.|:|....|..:.|:|.|.:.:...::..|..|.
Zfish   963 VCGACSKPIVGQVVTAMGRTWHPEHFVCTHCQEEIGSRNFFEREGQPYCERDYHHLFSPRCYYCN 1027

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            .|||:|.:.|:..:||.:.|.| ..|......:.|:|:|||.||:|||.||||.:|..|.:.|.:
Zfish  1028 GPILDKVVTALDRTWHPEHFFC-AQCGAFFGPEGFHEKDGKAYCRKDYFDLFAPKCGGCARAILE 1091

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            :.:.|::..||.:||.|.:|..|..:.:|.....:|.|
Zfish  1092 NYISALSSLWHPECFVCRECFTPFVNGSFFEHDGQPYC 1129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 22/50 (44%)
LIM 66..118 CDD:295319 20/51 (39%)
LIM 126..176 CDD:259829 14/48 (29%)
pxnbXP_021334029.1 Paxillin 96..272 CDD:308898
Atrophin-1 <178..684 CDD:331285
LIM1_Paxillin_like 964..1016 CDD:259830 22/51 (43%)
LIM2_Paxillin_like 1023..1074 CDD:188723 20/51 (39%)
LIM3_Paxillin_like 1082..1134 CDD:188724 14/48 (29%)
LIM4_Paxillin 1141..1192 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583870
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.840

Return to query results.
Submit another query.