DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and zyx

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_005157983.1 Gene:zyx / 564246 ZFINID:ZDB-GENE-070928-18 Length:608 Species:Danio rerio


Alignment Length:187 Identity:54/187 - (28%)
Similarity:88/187 - (47%) Gaps:18/187 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRM--ITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAG 68
            ||.||.|.:::..  :.|:.|.:|...|.|..|...:....|..:.|.|.|.:|::...: .|:.
Zfish   416 VCGKCGETLSRSQPAVRAMDKLFHSHCFCCVSCQRPLQGMQFYDRDGTPQCEECYMSSLS-VCSR 479

  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFY-ERDGKPYCKKDYEDLFAARCAKCEKP 132
            |.:.|.::.:.|||:.:|..||.| ..|...|....|. :.|.||||.|||...|:..|..|.:|
Zfish   480 CGERITDRVLKAMGQCFHAHCFLC-TTCNCSLEGAPFITDDDNKPYCVKDYHRRFSPLCVSCNEP 543

  Fly   133 ITDS-------AVLAMNVKWHRDCFRCNKCENPITSQT-----FTIDGDKPVCPACN 177
            |...       .|:|:...:|..|:||..|..|::.:.     :.::| |.:|..|:
Zfish   544 IIPDPGSEETVRVVALEKNFHLKCYRCEDCARPLSIEADADGCYPLNG-KILCMKCH 599

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 14/52 (27%)
LIM 66..118 CDD:295319 19/52 (37%)
LIM 126..176 CDD:259829 15/61 (25%)
zyxXP_005157983.1 LIM 383..470 CDD:295319 15/53 (28%)
LIM 477..535 CDD:295319 22/58 (38%)
LIM3_Zyxin 537..603 CDD:188819 16/64 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.