DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and lpxn

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_689239.4 Gene:lpxn / 560743 ZFINID:ZDB-GENE-081105-159 Length:405 Species:Danio rerio


Alignment Length:168 Identity:67/168 - (39%)
Similarity:97/168 - (57%) Gaps:3/168 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKK 71
            |..|.:.|..:||||||:.||||||:|..|.|::....|..:.|:|.|.|.:.:.::..||.||.
Zfish   172 CASCGKCIAGKMITALGQVWHPEHFVCSACREELGTCGFFERDGKPYCEKDYQKLFSPRCAYCKG 236

  Fly    72 PILEKTICAMGESWH-EDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            ||.:..:.||.::|| |..|||  .|......:.:.||||||||.:|:..|||.:|:.|.:|:.:
Zfish   237 PITQNILTAMDQTWHPEHFFCC--HCGDLFGPEGYLERDGKPYCSRDFYCLFAPKCSGCGEPVKE 299

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            :.:.|.|..||.|||.|:.|..|.|...|.....:|:|
Zfish   300 NYLSAANGTWHPDCFVCSDCLKPFTDGCFLELNGRPLC 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 23/50 (46%)
LIM 66..118 CDD:295319 23/52 (44%)
LIM 126..176 CDD:259829 17/48 (35%)
lpxnXP_689239.4 LIM1_Paxillin_like 172..224 CDD:259830 23/51 (45%)
LIM2_Leupaxin 231..282 CDD:188792 23/52 (44%)
LIM3_Leupaxin 290..342 CDD:188794 17/48 (35%)
LIM4_Leupaxin 349..400 CDD:188796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583862
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.