DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and LIMS2

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_060450.2 Gene:LIMS2 / 55679 HGNCID:16084 Length:365 Species:Homo sapiens


Alignment Length:172 Identity:55/172 - (31%)
Similarity:82/172 - (47%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|.:|...|.::.:......:||:||.|.||.:: |.|......||..|..|..:.....|..|:
Human   163 ICQRCHLVIDEQPLMFRSDAYHPDHFNCTHCGKE-LTAEARELKGELYCLPCHDKMGVPICGACR 226

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            :||..:.:.|:|:.||.:.|.| ..|:||......||:.|..||:..|..||...|..|...|..
Human   227 RPIEGRVVNALGKQWHVEHFVC-AKCEKPFLGHRHYEKKGLAYCETHYNQLFGDVCYNCSHVIEG 290

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGD-KPVCPAC 176
            ..|.|:|..|...||.|:.|.:.:|.:...::.| ||||..|
Human   291 DVVSALNKAWCVSCFSCSTCNSKLTLKNKFVEFDMKPVCKRC 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/50 (30%)
LIM 66..118 CDD:295319 18/51 (35%)
LIM 126..176 CDD:259829 17/50 (34%)
LIMS2NP_060450.2 LIM1_PINCH 39..97 CDD:188717
LIM2_PINCH 100..151 CDD:188718
LIM3_PINCH 164..214 CDD:188719 15/50 (30%)
LIM4_PINCH 220..273 CDD:188720 18/53 (34%)
LIM5_PINCH 281..334 CDD:188721 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.