DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and lims2

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_021334342.1 Gene:lims2 / 553696 ZFINID:ZDB-GENE-050522-56 Length:378 Species:Danio rerio


Alignment Length:233 Identity:59/233 - (25%)
Similarity:88/233 - (37%) Gaps:64/233 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT------ 65
            ||:|.|.:..|:|.|:..:|||:.|.|..|:..:.|..|....|.|:|..|...:...:      
Zfish   118 CHQCGEFVVGRVIKAMNSSWHPDCFCCEVCEAVLADVGFVKSGGRPLCRSCHSRQKALSLGKHVC 182

  Fly    66 --------------------------------------------------------CAGCKKPIL 74
                                                                    |..|::|:.
Zfish   183 QKCLCVVEEPLMYRSDPYHPDHFNCSHCGKELTADARELKGELYCLPCHDKLGVPICGACRRPVE 247

  Fly    75 EKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVL 139
            .:.:.|||:.||.:.|.| ..|:||......|||.|..||:..|..||...|.:|.:.|....|.
Zfish   248 GRVVNAMGKQWHVEHFVC-VKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFQCNRVIEGDVVS 311

  Fly   140 AMNVKWHRDCFRCNKCENPITSQTFTIDGD-KPVCPAC 176
            |:|..|...||.|:.|.:.:|.:...::.| ||||..|
Zfish   312 ALNKAWCVRCFSCSTCTSRLTLKDKFVEIDLKPVCKHC 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 18/50 (36%)
LIM 66..118 CDD:295319 19/51 (37%)
LIM 126..176 CDD:259829 17/50 (34%)
lims2XP_021334342.1 LIM1_PINCH 57..115 CDD:188717
LIM2_PINCH 118..169 CDD:188718 18/50 (36%)
LIM3_PINCH 182..231 CDD:188719 0/48 (0%)
LIM4_PINCH 237..290 CDD:188720 19/53 (36%)
LIM5_PINCH 298..351 CDD:188721 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.