DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and pdlim5

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_012817118.2 Gene:pdlim5 / 548530 XenbaseID:XB-GENE-854114 Length:884 Species:Xenopus tropicalis


Alignment Length:174 Identity:65/174 - (37%)
Similarity:91/174 - (52%) Gaps:3/174 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TESIVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTC 66
            |.:.:|..|.:.|....:.||||:||||.|.|.||...:.:..|..:.|...|..|:.:.:...|
 Frog   703 TRTPMCAICNKVIRGPFLLALGKSWHPEEFNCAHCKSSMAEMGFVEEKGGLYCEICYEKLFAPEC 767

  Fly    67 AGCKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEK 131
            |.|::.||.:.|.|:.::||..||.| .||:.|:.|..|:..||:|||:.||..||...|..||.
 Frog   768 ARCQRKILGEVINALKQTWHVSCFVC-VACQTPIRNSVFHLEDGEPYCETDYYSLFGTICHGCEF 831

  Fly   132 PIT--DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            ||.  |..:.|:...||..||.|..|...:..|||....||.:|
 Frog   832 PIEAGDRFLEALGHTWHNTCFVCTICCENLEGQTFFSKKDKLLC 875

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 18/50 (36%)
LIM 66..118 CDD:295319 22/51 (43%)
LIM 126..176 CDD:259829 19/50 (38%)
pdlim5XP_012817118.2 PDZ 10..83 CDD:214570
PRK14951 <80..216 CDD:237865
DUF4749 212..320 CDD:406377
LIM1_ENH 708..759 CDD:188837 18/50 (36%)
LIM2_Enigma_like 767..818 CDD:188748 22/51 (43%)
LIM3_ENH 826..880 CDD:188843 19/50 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.