DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and pk

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_724538.1 Gene:pk / 45343 FlyBaseID:FBgn0003090 Length:1299 Species:Drosophila melanogaster


Alignment Length:169 Identity:52/169 - (30%)
Similarity:79/169 - (46%) Gaps:12/169 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMI----TALG--KTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT 65
            |..|.:.|:...|    |.||  .:|||..|.|..|.|.::|..:..:.|...|.:...|.....
  Fly   624 CDGCDDLISTGDIAVFATRLGPNASWHPACFACSVCRELLVDLIYFHRDGRMYCGRHHAETLKPR 688

  Fly    66 CAGCKKPIL-EKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKC 129
            |:.|.:.|| ::...|.|.:||.:.|.| ..|.|.|..|.:..|:|||||...::.:||..|..|
  Fly   689 CSACDEIILADECTEAEGRAWHMNHFAC-HECDKQLGGQRYIMREGKPYCLHCFDAMFAEYCDYC 752

  Fly   130 EKPI-TDSAVLAMNVK-WHR--DCFRCNKCENPITSQTF 164
            .:.| .|...::.:.: ||.  :||.||.|...:..:.|
  Fly   753 GEAIGVDQGQMSHDGQHWHATDECFSCNTCRCSLLGRAF 791

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 17/56 (30%)
LIM 66..118 CDD:295319 20/52 (38%)
LIM 126..176 CDD:259829 12/43 (28%)
pkNP_724538.1 PET_Prickle 523..618 CDD:193602
LIM1_Prickle 624..682 CDD:188799 17/57 (30%)
LIM2_Prickle 687..742 CDD:188802 20/55 (36%)
LIM3_Prickle 747..805 CDD:188804 12/45 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
22.010

Return to query results.
Submit another query.