DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and fhl1a

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001007288.1 Gene:fhl1a / 399646 ZFINID:ZDB-GENE-040206-1 Length:297 Species:Danio rerio


Alignment Length:177 Identity:53/177 - (29%)
Similarity:79/177 - (44%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITK--RMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |..|.:.||.  :.:....|.||.|.|.|..|.:.|...:|..:..:..|..|..:::...|..|
Zfish   118 CQGCYKVITPGCKNVEYKHKVWHEECFTCFECKQPIRTQSFLTKGDDMYCTPCHEKKFAKHCVRC 182

  Fly    70 KKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPIT 134
            |:.|....:....:.||.:||.| ..||||||...|...:.:.||...|:...|.:|:.|:.|||
Zfish   183 KEAITSGGLTYQDQPWHSECFVC-HTCKKPLAGARFTAHEDQFYCVDCYKSDVAKKCSGCQNPIT 246

  Fly   135 -----DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
                 .:.|...:..||..||.|.||...:..:.|.|:|:...|..|
Zfish   247 GFGRGTNVVNYEDKSWHEYCFNCKKCSLSMAHKRFVINGEDIYCSDC 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 14/52 (27%)
LIM 66..118 CDD:295319 18/51 (35%)
LIM 126..176 CDD:259829 17/54 (31%)
fhl1aNP_001007288.1 LIM <21..49 CDD:295319
LIM1_FHL1 56..110 CDD:188730
LIM2_FHL1 118..175 CDD:188808 15/56 (27%)
LIM3_FHL1 179..231 CDD:188813 18/52 (35%)
LIM4_FHL1 234..297 CDD:188734 19/60 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.