DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and pxna

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_963882.1 Gene:pxna / 399546 ZFINID:ZDB-GENE-040105-1 Length:533 Species:Danio rerio


Alignment Length:170 Identity:63/170 - (37%)
Similarity:100/170 - (58%) Gaps:1/170 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            ||..|::.|..:::||:|:|||||||:|..|.|:|....|..:.|:|.|.|.:...::..|..|.
Zfish   299 VCGACKKPIAGQVVTAMGRTWHPEHFVCTQCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCS 363

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            .|||:|.:.|:.::||.:.|.| ..|......:.|:|::||.||:|||.|:||.:|..|.:.|.:
Zfish   364 GPILDKVVTALDKTWHPEHFFC-AQCGSFFGPEGFHEKEGKAYCRKDYFDMFAPKCGGCARAILE 427

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPA 175
            :.:.|:|..||.:||.|.:|..|..:.:|.....:|.|.|
Zfish   428 NYISALNSLWHPECFVCRECFTPFVNGSFFEHEGQPYCEA 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 22/50 (44%)
LIM 66..118 CDD:295319 19/51 (37%)
LIM 126..176 CDD:259829 16/50 (32%)
pxnaNP_963882.1 Paxillin 54..229 CDD:281527
LIM1_Paxillin_like 300..352 CDD:259830 22/51 (43%)
LIM2_Paxillin 359..410 CDD:188791 19/51 (37%)
LIM3_Paxillin 418..470 CDD:188793 16/50 (32%)
LIM4_Paxillin 477..528 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.