DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and ldb3

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_017950805.1 Gene:ldb3 / 394699 XenbaseID:XB-GENE-922381 Length:818 Species:Xenopus tropicalis


Alignment Length:170 Identity:61/170 - (35%)
Similarity:91/170 - (53%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|...|....:.|:|::||||.|.|.||...:.|.:|..:.....|.:|:.:.:..|||.|.
 Frog   641 LCASCNSIIRGPFLVAMGRSWHPEEFNCAHCKTSLADVSFVEEQKGVYCERCYEQFFAPTCARCN 705

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPIT- 134
            ..|:.:.:.|:.::||..||.| .||:||..|..|:..||:|||:|||..||:.:|..|:.|:. 
 Frog   706 TKIMGEVMHALRQTWHTTCFVC-AACRKPFGNSLFHMEDGEPYCEKDYVALFSTKCHGCDFPVEA 769

  Fly   135 -DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|...:..|.|....|||:|
 Frog   770 GDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDKPLC 809

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 16/50 (32%)
LIM 66..118 CDD:295319 22/51 (43%)
LIM 126..176 CDD:259829 17/50 (34%)
ldb3XP_017950805.1 PDZ_signaling 8..81 CDD:238492
DUF4749 209..310 CDD:406377
gliding_GltJ <462..>640 CDD:411345
LIM1_ZASP_Cypher 642..693 CDD:188838 16/50 (32%)
LIM2_Enigma_like 701..752 CDD:188748 22/51 (43%)
LIM3_Enigma_like 760..813 CDD:188749 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.