DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and fhl1b

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_954687.1 Gene:fhl1b / 387528 ZFINID:ZDB-GENE-031219-1 Length:280 Species:Danio rerio


Alignment Length:174 Identity:58/174 - (33%)
Similarity:86/174 - (49%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:|:..|:  .:.:...||.||.:.|.|..|.:.:...:|..:....:|..|........|.||
Zfish    40 CTECRRTISTDSKELHHKGKYWHSDCFRCAKCYKNLAKESFTSKDDRILCGTCSSREDAPRCHGC 104

  Fly    70 KKPILEKT--ICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKP 132
            .||||..|  :...|.|||::||.| ..|:||:.|::|..::...||...:|..||.:||.|:||
Zfish   105 YKPILPGTENVEYKGNSWHDECFKC-YQCQKPIGNKSFITKNNNVYCSPCHEKKFAKQCACCKKP 168

  Fly   133 ITDSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
            ||...|...:..||.:||.|:.|..|:....||...:|..|..|
Zfish   169 ITTGGVNYQDQPWHSECFVCSSCRKPLAGTRFTSHEEKVYCVDC 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 12/52 (23%)
LIM 66..118 CDD:295319 22/53 (42%)
LIM 126..176 CDD:259829 19/49 (39%)
fhl1bNP_954687.1 LIM1_FHL1 40..93 CDD:188730 12/52 (23%)
LIM2_FHL1 101..158 CDD:188808 23/57 (40%)
LIM3_FHL1 162..214 CDD:188813 20/51 (39%)
LIM4_FHL1 217..280 CDD:188734
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11189
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4575
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.