DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Zasp52

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027420.2 Gene:Zasp52 / 36740 FlyBaseID:FBgn0265991 Length:2194 Species:Drosophila melanogaster


Alignment Length:172 Identity:59/172 - (34%)
Similarity:88/172 - (51%) Gaps:5/172 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLC--HHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAG 68
            :|:.|...|....|||||:.|.|:||:|  .:|...:.|..|..:.|:..|..||.:....||:.
  Fly  2019 LCNSCNVQIRGPFITALGRIWCPDHFICVNGNCRRPLQDIGFVEEKGDLYCEYCFEKYLAPTCSK 2083

  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133
            |...|....:.|:|:.:|.:||.| |.|.|...|:.|:..||..||:.|:.:||..:|..|..|:
  Fly  2084 CAGKIKGDCLNAIGKHFHPECFTC-GQCGKIFGNRPFFLEDGNAYCEADWNELFTTKCFACGFPV 2147

  Fly   134 T--DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            .  |..|.|:|..:|..||.|..|:..:..|:|...|.:|.|
  Fly  2148 EAGDRWVEALNHNYHSQCFNCTFCKQNLEGQSFYNKGGRPFC 2189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 18/52 (35%)
LIM 66..118 CDD:295319 18/51 (35%)
LIM 126..176 CDD:259829 17/50 (34%)
Zasp52NP_001027420.2 PDZ_signaling 6..87 CDD:238492
DUF4749 150..>217 CDD:292558
LIM_ALP_like 282..333 CDD:188746
LIM1_Enigma_like_1 2020..2073 CDD:188839 18/52 (35%)
LIM 2081..2132 CDD:259829 18/51 (35%)
LIM3_Enigma_like_1 2140..2193 CDD:188845 17/50 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 50 1.000 Domainoid score I3371
eggNOG 1 0.900 - - E1_KOG1703
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.