DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Pxn

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_038945530.1 Gene:Pxn / 360820 RGDID:1305759 Length:1125 Species:Rattus norvegicus


Alignment Length:168 Identity:65/168 - (38%)
Similarity:99/168 - (58%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            ||..|::.|..:::||:|||||||||:|.||.|:|....|..:.|:|.|.|.:...::..|..|.
  Rat   891 VCGACKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCN 955

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            .|||:|.:.|:..:||.:.|.| ..|......:.|:|:|||.||:|||.|:||.:|..|.:.|.:
  Rat   956 GPILDKVVTALDRTWHPEHFFC-AQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILE 1019

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            :.:.|:|..||.:||.|.:|..|..:.:|.....:|.|
  Rat  1020 NYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYC 1057

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 24/50 (48%)
LIM 66..118 CDD:295319 20/51 (39%)
LIM 126..176 CDD:259829 15/48 (31%)
PxnXP_038945530.1 Paxillin 121..320 CDD:397550
LIM1_Paxillin_like 892..944 CDD:259830 24/51 (47%)
LIM2_Paxillin 951..1002 CDD:188791 20/51 (39%)
LIM3_Paxillin_like 1010..1062 CDD:188724 15/48 (31%)
LIM4_Paxillin 1069..1120 CDD:188795
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343625
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.