DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and CG31624

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001163031.1 Gene:CG31624 / 35393 FlyBaseID:FBgn0051624 Length:178 Species:Drosophila melanogaster


Alignment Length:178 Identity:171/178 - (96%)
Similarity:176/178 - (98%) Gaps:0/178 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MTESIVCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYT 65

  Fly    66 CAGCKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCE 130
            ||||||||||||||||||.|||.|||||||||||||:|||||||||||||:|||:||||||||||
  Fly    66 CAGCKKPILEKTICAMGERWHEACFCCGGACKKPLASQTFYERDGKPYCKQDYENLFAARCAKCE 130

  Fly   131 KPITDSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPACNC 178
            |||||||||||||||||:||:|||||||||||||||||||||||||||
  Fly   131 KPITDSAVLAMNVKWHRNCFQCNKCENPITSQTFTIDGDKPVCPACNC 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 50/50 (100%)
LIM 66..118 CDD:295319 47/51 (92%)
LIM 126..176 CDD:259829 47/49 (96%)
CG31624NP_001163031.1 LIM 7..58 CDD:351770 50/50 (100%)
LIM 66..118 CDD:351770 47/51 (92%)
LIM 125..176 CDD:214528 48/50 (96%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449837
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 1 1.000 - - H113488
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D249616at33208
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
109.790

Return to query results.
Submit another query.