DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and CG34325

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001097003.1 Gene:CG34325 / 32656 FlyBaseID:FBgn0085354 Length:179 Species:Drosophila melanogaster


Alignment Length:172 Identity:96/172 - (55%)
Similarity:132/172 - (76%) Gaps:0/172 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :||||.|.|..|:|||||||||||||:|..|...|.:|:||:..|:|||:.|||..|:..|.|||
  Fly     7 ICHKCNEVIQLRIITALGKTWHPEHFVCKDCQCPITEASFNINDGQPVCSACFVSNYSGICHGCK 71

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            :||||:||.||||:|||:||.|.|.|.:.||..:|||.||.|||:.|:|.:|||||..|:.|||:
  Fly    72 RPILERTIKAMGETWHEECFLCRGPCMQQLAGSSFYEHDGLPYCRTDFEHMFAARCGNCKAPITE 136

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPACN 177
            :|::|::.||||:||:|.||:.|||:.:|.::.::|:|.||:
  Fly   137 NAIVALDAKWHRECFKCKKCKTPITASSFVVEDNQPLCKACS 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 30/50 (60%)
LIM 66..118 CDD:295319 32/51 (63%)
LIM 126..176 CDD:259829 22/49 (45%)
CG34325NP_001097003.1 LIM 8..59 CDD:295319 30/50 (60%)
LIM 67..119 CDD:295319 32/51 (63%)
LIM 127..175 CDD:295319 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449838
Domainoid 1 1.000 47 0.796 Domainoid score I4515
eggNOG 1 0.900 - - E1_KOG1703
Homologene 1 1.000 - - H113488
Inparanoid 1 1.050 56 1.000 Inparanoid score I2587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 1 1.000 - - otm47179
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
98.890

Return to query results.
Submit another query.