DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Fhl5

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001013106.1 Gene:Fhl5 / 297954 RGDID:1307056 Length:284 Species:Rattus norvegicus


Alignment Length:177 Identity:56/177 - (31%)
Similarity:82/177 - (46%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAIT--KRMITALGKTWHPEHFLCHHCDEQI-LDATFNVQSGEPVCNKCFVERYTYTCAG 68
            |..|:..|.  .|.:...|..||...|:|.||.:.| .....:.:||. .|..||.:.:.:.|..
  Rat   102 CFHCKRTIMPGSRKMEFKGNYWHETCFVCEHCRQPIGTKPLISKESGN-YCVPCFEKEFAHYCNF 165

  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133
            |||.|....|....:.||::||.|.| |:|.|..:.|..:|..|:|...|..|:|.:||.|.|||
  Rat   166 CKKVITSGGITFRDQIWHKECFLCSG-CRKELYEEAFMSKDDFPFCLDCYNHLYAKKCAACTKPI 229

  Fly   134 TD----SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
            |.    ..:...:.:||.:||.|.||...:..:.|.....:.:|..|
  Rat   230 TGLRGAKFICFQDRQWHSECFNCGKCSVSLVGEGFLTQNMEILCRKC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/53 (28%)
LIM 66..118 CDD:295319 19/51 (37%)
LIM 126..176 CDD:259829 16/53 (30%)
Fhl5NP_001013106.1 LIM <6..34 CDD:413332
LIM1_FHL 37..95 CDD:188729
LIM2_FHL5 102..155 CDD:188812 15/53 (28%)
LIM 163..214 CDD:413332 19/51 (37%)
LIM4_FHL 222..277 CDD:188733 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
66.010

Return to query results.
Submit another query.