DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Fhl1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006257733.1 Gene:Fhl1 / 25177 RGDID:2615 Length:339 Species:Rattus norvegicus


Alignment Length:213 Identity:58/213 - (27%)
Similarity:86/213 - (40%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAI----------------------------TKRMITALGKT-------WHPEH 30
            |:|...||.|::.:                            .::.|:|..|.       ||...
  Rat    17 MSEKFDCHYCRDPLQGKKYVQKDGRHCCLKCFDKFCANTCVECRKPISADAKEVHYKNRYWHDTC 81

  Fly    31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPIL--EKTICAMGESWHEDCFCCG 93
            |.|..|...:...||..:.|:.:||||.....:..|.||.|.|:  ::.:...|..||:|||.|.
  Rat    82 FRCAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGCFKAIVAGDQNVEYKGTIWHKDCFTCS 146

  Fly    94 GACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCFRCNKCENP 158
            . ||:.:...:|:.:....||...:|..||..|.||.|.||...:...:..||.:||.|..|...
  Rat   147 N-CKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHAECFVCVTCSKK 210

  Fly   159 ITSQTFTIDGDKPVCPAC 176
            :..|.||...|:..|..|
  Rat   211 LAGQRFTAVEDQYYCVDC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 17/85 (20%)
LIM 66..118 CDD:295319 17/53 (32%)
LIM 126..176 CDD:259829 17/49 (35%)
Fhl1XP_006257733.1 LIM <21..49 CDD:351770 3/27 (11%)
LIM1_FHL1 56..109 CDD:188730 14/52 (27%)
LIM2_FHL1 117..174 CDD:188808 18/57 (32%)
LIM3_FHL1 178..230 CDD:188813 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10711
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.