DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Pdlim4

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001380800.1 Gene:Pdlim4 / 24915 RGDID:3575 Length:335 Species:Rattus norvegicus


Alignment Length:30 Identity:11/30 - (36%)
Similarity:16/30 - (53%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHC 36
            |.:|...|...::.|..|.:|||.|:|..|
  Rat   260 CTRCGHGIVGTIVKARDKLYHPECFMCSDC 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 11/30 (37%)
LIM 66..118 CDD:295319
LIM 126..176 CDD:259829
Pdlim4NP_001380800.1 PDZ_signaling 2..80 CDD:238492
DUF4749 139..235 CDD:406377
LIM_RIL 260..312 CDD:188835 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.