DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and FHL2

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001034581.1 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:177 Identity:58/177 - (32%)
Similarity:89/177 - (50%) Gaps:9/177 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI---TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAG 68
            |.:|::.|   |::| ...|.:||...|:||.|.:.|...:|..:..:..|..|:.:::...|..
Human   101 CQECKKTIMPGTRKM-EYKGSSWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQ 164

  Fly    69 CKKPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133
            |||||....:....:.||::||.| .||:|.|:.|.|..||...||...:.||:|.:||.|..||
Human   165 CKKPITTGGVTYREQPWHKECFVC-TACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPI 228

  Fly   134 T----DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
            :    ...:.....:||.|||.|.||...:..:.|..:.|..:||.|
Human   229 SGLGGTKYISFEERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDC 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/53 (28%)
LIM 66..118 CDD:295319 21/51 (41%)
LIM 126..176 CDD:259829 17/53 (32%)
FHL2NP_001034581.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806
LIM2_FHL2 101..157 CDD:188810 16/56 (29%)
LIM3_Fhl2 162..218 CDD:188815 23/56 (41%)
LIM4_FHL2 221..278 CDD:188817 18/55 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I4662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.