DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and F33D11.1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_491698.1 Gene:F33D11.1 / 185224 WormBaseID:WBGene00018000 Length:131 Species:Caenorhabditis elegans


Alignment Length:147 Identity:39/147 - (26%)
Similarity:58/147 - (39%) Gaps:37/147 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI-TKRMITALGKTWHPEHFLCHHCDEQILDATFNV-QSGEPVCNKCFVERYTYTCAGC 69
            |..|...: .:..|...||.||..|.||..|:.:|.|....| |:|..:|::|.::.....|.||
 Worm     4 CGHCSVKVGEESAILTNGKVWHVNHLLCDLCNCRINDGERCVPQNGVILCSECHIKTTRPICKGC 68

  Fly    70 KKPILEKTIC-AMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPI 133
            .: .::..:| |:..:||..||.| ..|:|||              :.|:..|....|.      
 Worm    69 GE-FIKTNLCEALNSTWHPTCFQC-SVCQKPL--------------EVDFHQLPNRMCV------ 111

  Fly   134 TDSAVLAMNVKWHRDCF 150
                        |.|||
 Worm   112 ------------HSDCF 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 17/52 (33%)
LIM 66..118 CDD:295319 14/52 (27%)
LIM 126..176 CDD:259829 5/25 (20%)
F33D11.1NP_491698.1 LIM 4..57 CDD:295319 17/52 (33%)
LIM 65..>97 CDD:295319 11/33 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161132
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.