DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and unc-95

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_740934.2 Gene:unc-95 / 173301 WormBaseID:WBGene00006824 Length:350 Species:Caenorhabditis elegans


Alignment Length:64 Identity:19/64 - (29%)
Similarity:32/64 - (50%) Gaps:7/64 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITAL------GKTWHPEHFLCHHCDEQI-LDATFNVQSGEPVCNKCFVERY 62
            ||..|.|.|...::|||      .:.:|..||:|.:|.:.: :..|:.....:|.|:.||.:.|
 Worm   269 VCAYCSEEIDGAILTALAPNSERAQKFHTYHFMCTYCQKALNMHGTYREHDLKPYCHDCFYKLY 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829
LIM 7..58 CDD:413332 15/57 (26%)
LIM 66..118 CDD:413332
unc-95NP_740934.2 LIM4_Paxillin_like 270..328 CDD:188725 15/57 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.