DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Lmo2

DIOPT Version :10

Sequence 1:NP_610098.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_032531.2 Gene:Lmo2 / 16909 MGIID:102811 Length:228 Species:Mus musculus


Alignment Length:115 Identity:37/115 - (32%)
Similarity:58/115 - (50%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGEPVCNKCFVERYTYTCAGCKKPILEK-TICAMGESWHEDCFCCG-GACKKPLANQTFYERDGK 111
            |.|||.....:.....||.||::.|.:: .:.|:.:.|||||..|. ..|:.....:..|.:.|:
Mouse    83 SEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGR 147

  Fly   112 PYCKKDYEDLFA--ARCAKCEKPITDSAVLAMNVK---WHRDCFRCNKCE 156
            ..|::||..||.  ..||.|:|.|. :..:.|.||   :|.:||:|..|:
Mouse   148 KLCRRDYLRLFGQDGLCASCDKRIR-AYEMTMRVKDKVYHLECFKCAACQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_610098.1 LIM 126..176 CDD:259829 13/34 (38%)
LIM 7..58 CDD:413332 4/8 (50%)
LIM 66..118 CDD:413332 15/53 (28%)
Lmo2NP_032531.2 LIM1_LMO2 100..155 CDD:188770 16/54 (30%)
LIM2_LMO2 164..219 CDD:188771 13/34 (38%)

Return to query results.
Submit another query.