DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Lmo2

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_032531.2 Gene:Lmo2 / 16909 MGIID:102811 Length:228 Species:Mus musculus


Alignment Length:115 Identity:37/115 - (32%)
Similarity:58/115 - (50%) Gaps:8/115 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SGEPVCNKCFVERYTYTCAGCKKPILEK-TICAMGESWHEDCFCCG-GACKKPLANQTFYERDGK 111
            |.|||.....:.....||.||::.|.:: .:.|:.:.|||||..|. ..|:.....:..|.:.|:
Mouse    83 SEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRRLYYKLGR 147

  Fly   112 PYCKKDYEDLFA--ARCAKCEKPITDSAVLAMNVK---WHRDCFRCNKCE 156
            ..|::||..||.  ..||.|:|.|. :..:.|.||   :|.:||:|..|:
Mouse   148 KLCRRDYLRLFGQDGLCASCDKRIR-AYEMTMRVKDKVYHLECFKCAACQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 4/8 (50%)
LIM 66..118 CDD:295319 15/53 (28%)
LIM 126..176 CDD:259829 13/34 (38%)
Lmo2NP_032531.2 LIM1_LMO2 100..155 CDD:188770 16/54 (30%)
LIM2_LMO2 164..219 CDD:188771 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.