DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Fhl3

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006502829.1 Gene:Fhl3 / 14201 MGIID:1341092 Length:303 Species:Mus musculus


Alignment Length:174 Identity:59/174 - (33%)
Similarity:90/174 - (51%) Gaps:5/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAI--TKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGC 69
            |.:||:.|  ..|.:....:.:|...|.|..|...:.|..|..|..|.:||:|:...::..|:.|
Mouse    54 CAECQQLIGHDSRELFYEDRHFHEGCFRCCRCQRSLADEPFTCQDSELLCNECYCTAFSSQCSAC 118

  Fly    70 KKPIL--EKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKP 132
            .:.::  .:.:...|::|||.||.|.| |::||.:::|....|..||...||:.||.|||:|.|.
Mouse   119 GETVMPGSRKLEYGGQTWHEHCFLCSG-CEQPLGSRSFVPDKGAHYCVPCYENKFAPRCARCSKT 182

  Fly   133 ITDSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVCPAC 176
            :|...|...:..|||:|..|..|:.|:..|.||...|.|.|.||
Mouse   183 LTQGGVTYRDQPWHRECLVCTGCKTPLAGQQFTSRDDDPYCVAC 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/52 (29%)
LIM 66..118 CDD:295319 17/53 (32%)
LIM 126..176 CDD:259829 19/49 (39%)
Fhl3XP_006502829.1 LIM <19..47 CDD:351770
LIM1_FHL3 50..108 CDD:188807 16/53 (30%)
LIM2_FHL3 112..169 CDD:188811 17/57 (30%)
LIM3_FHL 176..227 CDD:188732 21/51 (41%)
LIM 235..299 CDD:351770
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104605
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.910

Return to query results.
Submit another query.