Sequence 1: | NP_001286122.1 | Gene: | CG31988 / 326182 | FlyBaseID: | FBgn0051988 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276462.1 | Gene: | Fhl2 / 14200 | MGIID: | 1338762 | Length: | 279 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 62/215 - (28%) |
---|---|---|---|
Similarity: | 95/215 - (44%) | Gaps: | 38/215 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTESIVCHKCQEAI-TKRMI------------------------TALG----------KTWHPEH 30
Fly 31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPILEKT--ICAMGESWHEDCFCCG 93
Fly 94 GACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCFRCNKCENP 158
Fly 159 ITSQTFTIDGDKPVCPACNC 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31988 | NP_001286122.1 | LIM | 7..58 | CDD:295319 | 16/85 (19%) |
LIM | 66..118 | CDD:295319 | 18/53 (34%) | ||
LIM | 126..176 | CDD:259829 | 18/49 (37%) | ||
Fhl2 | NP_001276462.1 | LIM | <5..33 | CDD:413332 | 6/27 (22%) |
LIM | 36..97 | CDD:413332 | 11/60 (18%) | ||
LIM | 101..157 | CDD:413332 | 20/56 (36%) | ||
LIM | 162..218 | CDD:413332 | 20/53 (38%) | ||
LIM4_FHL2 | 221..278 | CDD:188817 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 131 | 1.000 | Inparanoid score | I4604 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 1 | 0.900 | - | - | OOG6_104605 | |
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.950 |