Sequence 1: | NP_001286122.1 | Gene: | CG31988 / 326182 | FlyBaseID: | FBgn0051988 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006527864.1 | Gene: | Fhl1 / 14199 | MGIID: | 1298387 | Length: | 339 | Species: | Mus musculus |
Alignment Length: | 213 | Identity: | 58/213 - (27%) |
---|---|---|---|
Similarity: | 86/213 - (40%) | Gaps: | 38/213 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTESIVCHKCQEAI----------------------------TKRMITALGKT-------WHPEH 30
Fly 31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPIL--EKTICAMGESWHEDCFCCG 93
Fly 94 GACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCFRCNKCENP 158
Fly 159 ITSQTFTIDGDKPVCPAC 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31988 | NP_001286122.1 | LIM | 7..58 | CDD:295319 | 17/85 (20%) |
LIM | 66..118 | CDD:295319 | 17/53 (32%) | ||
LIM | 126..176 | CDD:259829 | 17/49 (35%) | ||
Fhl1 | XP_006527864.1 | LIM | <21..49 | CDD:351770 | 3/27 (11%) |
LIM1_FHL1 | 56..109 | CDD:188730 | 14/52 (27%) | ||
LIM2_FHL1 | 117..174 | CDD:188808 | 18/57 (32%) | ||
LIM3_FHL1 | 178..230 | CDD:188813 | 18/51 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 131 | 1.000 | Inparanoid score | I4604 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.050 |