DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and Fhl1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_006527864.1 Gene:Fhl1 / 14199 MGIID:1298387 Length:339 Species:Mus musculus


Alignment Length:213 Identity:58/213 - (27%)
Similarity:86/213 - (40%) Gaps:38/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTESIVCHKCQEAI----------------------------TKRMITALGKT-------WHPEH 30
            |:|...||.|::.:                            .::.|:|..|.       ||...
Mouse    17 MSEKFDCHYCRDPLQGKKYVQKDGRHCCLKCFDKFCANTCVDCRKPISADAKEVHYKNRYWHDNC 81

  Fly    31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPIL--EKTICAMGESWHEDCFCCG 93
            |.|..|...:...||..:.|:.:||||.....:..|.||.|.|:  ::.:...|..||:|||.|.
Mouse    82 FRCAKCLHPLASETFVSKDGKILCNKCATREDSPRCKGCFKAIVAGDQNVEYKGTVWHKDCFTCS 146

  Fly    94 GACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCFRCNKCENP 158
            . ||:.:...:|:.:....||...:|..||..|.||.|.||...:...:..||.:||.|..|...
Mouse   147 N-CKQVIGTGSFFPKGEDFYCVTCHETKFAKHCVKCNKAITSGGITYQDQPWHAECFVCVTCSKK 210

  Fly   159 ITSQTFTIDGDKPVCPAC 176
            :..|.||...|:..|..|
Mouse   211 LAGQRFTAVEDQYYCVDC 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 17/85 (20%)
LIM 66..118 CDD:295319 17/53 (32%)
LIM 126..176 CDD:259829 17/49 (35%)
Fhl1XP_006527864.1 LIM <21..49 CDD:351770 3/27 (11%)
LIM1_FHL1 56..109 CDD:188730 14/52 (27%)
LIM2_FHL1 117..174 CDD:188808 18/57 (32%)
LIM3_FHL1 178..230 CDD:188813 18/51 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4604
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.