DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31988 and Pdlim3

DIOPT Version :9

Sequence 1:	NP_001286122.1	Gene:	CG31988 / 326182	FlyBaseID:	FBgn0051988	Length:	178	Species:	Drosophila melanogaster
Sequence 2:	NP_446102.2	Gene:	Pdlim3 / 114108	RGDID:	620427	Length:	364	Species:	Rattus norvegicus

Alignment Length:	49	Identity:	15/49 - (30%)
Similarity:	22/49 - (44%)	Gaps:	0/49 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVC 54
            :|.||...|...::.|..|..|||.|:|..|:..:....:....||..|
  Rat   293 LCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELYC 341

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31988	NP_001286122.1	LIM	7..58	CDD:295319	15/48 (31%)
		LIM	66..118	CDD:295319
		LIM	126..176	CDD:259829
Pdlim3	NP_446102.2	PDZ_signaling	2..80	CDD:238492
		DUF4749	184..263	CDD:406377
		LIM_ALP	294..346	CDD:188834	15/48 (31%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1703
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900