DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and LDB3

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001165081.1 Gene:LDB3 / 11155 HGNCID:15710 Length:732 Species:Homo sapiens


Alignment Length:170 Identity:59/170 - (34%)
Similarity:90/170 - (52%) Gaps:3/170 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..|...|....:.|:|::||||.|.|.:|...:.|..|..:.....|.:|:.:.:...||.|.
Human   555 LCGHCNNVIRGPFLVAMGRSWHPEEFTCAYCKTSLADVCFVEEQNNVYCERCYEQFFAPLCAKCN 619

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPIT- 134
            ..|:.:.:.|:.::||..||.| .|||||..|..|:..||:|||:|||.:||:.:|..|:.|:. 
Human   620 TKIMGEVMHALRQTWHTTCFVC-AACKKPFGNSLFHMEDGEPYCEKDYINLFSTKCHGCDFPVEA 683

  Fly   135 -DSAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
             |..:.|:...||..||.|..|...:..|.|....|:|:|
Human   684 GDKFIEALGHTWHDTCFICAVCHVNLEGQPFYSKKDRPLC 723

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 15/50 (30%)
LIM 66..118 CDD:295319 23/51 (45%)
LIM 126..176 CDD:259829 16/50 (32%)
LDB3NP_001165081.1 PDZ_signaling 5..81 CDD:238492
DUF4045 <77..180 CDD:330572
ZM 189..214 CDD:128974
DUF4749 263..353 CDD:318205
Atrophin-1 <387..554 CDD:331285
LIM1_ZASP_Cypher 556..607 CDD:188838 15/50 (30%)
LIM2_Enigma_like 615..666 CDD:188748 23/51 (45%)
LIM3_Enigma_like 674..727 CDD:188749 16/50 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1703
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.