DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and LIMS4

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001358269.1 Gene:LIMS4 / 100288695 HGNCID:39941 Length:398 Species:Homo sapiens


Alignment Length:234 Identity:65/234 - (27%)
Similarity:89/234 - (38%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQS-----------------GEPVC 54
            ||:|.|.|..|:|.|:..:||||.|.|..|.|.:.|..|...:                 |:.:|
Human   133 CHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLCRPCHNREKARGLGKYIC 197

  Fly    55 NKCFV-------------------------------------ERYTY---------TCAGCKKPI 73
            .||..                                     |.|..         .|..|::||
Human   198 QKCHAIIDEQPLIFKNDPYHPDHFNCANCGKDLTADAQELKGELYCLPCHDKMGVPICGACRRPI 262

  Fly    74 LEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAV 138
            ..:.:.|||:.||.:.|.| ..|:||......|||.|..||:..|..||...|..|.:.|....|
Human   263 EGRVVNAMGKQWHVEHFVC-AKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVV 326

  Fly   139 LAMNVKWHRDCFRCNKCENPITSQTFTIDGD-KPVCPAC 176
            .|:|..|..:||.|:.|...:|.:...::.| ||||..|
Human   327 SALNKAWCVNCFACSTCNTKLTLKDKFVEIDLKPVCKHC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 21/67 (31%)
LIM 66..118 CDD:295319 20/51 (39%)
LIM 126..176 CDD:259829 17/50 (34%)
LIMS4NP_001358269.1 LIM1_PINCH 72..130 CDD:188717
LIM2_PINCH 133..184 CDD:188718 18/50 (36%)
LIM3_PINCH 197..247 CDD:188719 5/49 (10%)
LIM4_PINCH 253..306 CDD:188720 20/53 (38%)
LIM5_PINCH 314..367 CDD:188721 18/52 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.