Sequence 1: | NP_001286122.1 | Gene: | CG31988 / 326182 | FlyBaseID: | FBgn0051988 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_012812021.1 | Gene: | lims1 / 100216119 | XenbaseID: | XB-GENE-967923 | Length: | 397 | Species: | Xenopus tropicalis |
Alignment Length: | 234 | Identity: | 63/234 - (26%) |
---|---|---|---|
Similarity: | 88/234 - (37%) | Gaps: | 65/234 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQS-----------------GEPVC 54
Fly 55 NKCFV-------------------------------------ERYTY---------TCAGCKKPI 73
Fly 74 LEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAV 138
Fly 139 LAMNVKWHRDCFRCNKCENPITSQTFTIDGD-KPVCPAC 176 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31988 | NP_001286122.1 | LIM | 7..58 | CDD:295319 | 20/67 (30%) |
LIM | 66..118 | CDD:295319 | 20/51 (39%) | ||
LIM | 126..176 | CDD:259829 | 16/50 (32%) | ||
lims1 | XP_012812021.1 | LIM1_PINCH | 73..131 | CDD:188717 | |
LIM2_PINCH | 134..185 | CDD:188718 | 17/50 (34%) | ||
LIM3_PINCH | 198..248 | CDD:188719 | 5/49 (10%) | ||
LIM4_PINCH | 254..307 | CDD:188720 | 20/53 (38%) | ||
LIM5_PINCH | 315..368 | CDD:188721 | 17/52 (33%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1593918at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 4.010 |