DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and lims1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_012812021.1 Gene:lims1 / 100216119 XenbaseID:XB-GENE-967923 Length:397 Species:Xenopus tropicalis


Alignment Length:234 Identity:63/234 - (26%)
Similarity:88/234 - (37%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 CHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQS-----------------GEPVC 54
            ||:|.|.|..|:|.|:..:||||.|.|..|.:.:.|..|...:                 |:.:|
 Frog   134 CHQCGEFIIGRVIKAMNNSWHPECFRCDICQQVLADIGFVKNAGRHLCRPCHNREKARGLGKYIC 198

  Fly    55 NKCFV-------------------------------------ERYTY---------TCAGCKKPI 73
            .||..                                     |.|..         .|..|::||
 Frog   199 QKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGELYCLPCHDKMGVPICGACRRPI 263

  Fly    74 LEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAV 138
            ..:.:.|||:.||.:.|.| ..|:||......|||.|..||:..|..||...|..|.:.|....|
 Frog   264 EGRVVNAMGKQWHVEHFVC-AKCEKPFLGHRHYERKGLAYCETHYNQLFGDVCFHCNRVIEGDVV 327

  Fly   139 LAMNVKWHRDCFRCNKCENPITSQTFTIDGD-KPVCPAC 176
            .|:|..|..:||.|:.|...:|.:...::.| ||.|..|
 Frog   328 SALNKAWCVNCFACSTCNTKLTLKHKFVEIDLKPTCKHC 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 20/67 (30%)
LIM 66..118 CDD:295319 20/51 (39%)
LIM 126..176 CDD:259829 16/50 (32%)
lims1XP_012812021.1 LIM1_PINCH 73..131 CDD:188717
LIM2_PINCH 134..185 CDD:188718 17/50 (34%)
LIM3_PINCH 198..248 CDD:188719 5/49 (10%)
LIM4_PINCH 254..307 CDD:188720 20/53 (38%)
LIM5_PINCH 315..368 CDD:188721 17/52 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.