Sequence 1: | NP_001286122.1 | Gene: | CG31988 / 326182 | FlyBaseID: | FBgn0051988 | Length: | 178 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001120233.1 | Gene: | fhl2 / 100145283 | XenbaseID: | XB-GENE-969632 | Length: | 279 | Species: | Xenopus tropicalis |
Alignment Length: | 215 | Identity: | 63/215 - (29%) |
---|---|---|---|
Similarity: | 95/215 - (44%) | Gaps: | 38/215 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MTESIVCHKCQEAI----------------------------TKRMITALGKT-------WHPEH 30
Fly 31 FLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCKKPILEKT--ICAMGESWHEDCFCCG 93
Fly 94 GACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITDSAVLAMNVKWHRDCFRCNKCENP 158
Fly 159 ITSQTFTIDGDKPVCPACNC 178 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31988 | NP_001286122.1 | LIM | 7..58 | CDD:295319 | 16/85 (19%) |
LIM | 66..118 | CDD:295319 | 19/53 (36%) | ||
LIM | 126..176 | CDD:259829 | 17/49 (35%) | ||
fhl2 | NP_001120233.1 | LIM | <5..33 | CDD:413332 | 4/27 (15%) |
LIM1_FHL2 | 36..97 | CDD:188806 | 13/60 (22%) | ||
LIM2_FHL2 | 101..157 | CDD:188810 | 21/56 (38%) | ||
LIM3_Fhl2 | 162..218 | CDD:188815 | 19/53 (36%) | ||
LIM4_FHL2 | 221..278 | CDD:188817 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 126 | 1.000 | Inparanoid score | I4543 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000055 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X39 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.050 |