DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31988 and tgfb1i1

DIOPT Version :9

Sequence 1:NP_001286122.1 Gene:CG31988 / 326182 FlyBaseID:FBgn0051988 Length:178 Species:Drosophila melanogaster
Sequence 2:XP_012825390.2 Gene:tgfb1i1 / 100038241 XenbaseID:XB-GENE-493249 Length:503 Species:Xenopus tropicalis


Alignment Length:168 Identity:67/168 - (39%)
Similarity:95/168 - (56%) Gaps:1/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VCHKCQEAITKRMITALGKTWHPEHFLCHHCDEQILDATFNVQSGEPVCNKCFVERYTYTCAGCK 70
            :|..||..|..:::||||.|||||||:|.||...|....|..:.|.|.|.|.:...|...||.|:
 Frog   269 LCESCQRPIAGQVVTALGHTWHPEHFVCAHCHALIGTTNFFEKDGRPYCEKDYFMLYAPRCALCE 333

  Fly    71 KPILEKTICAMGESWHEDCFCCGGACKKPLANQTFYERDGKPYCKKDYEDLFAARCAKCEKPITD 135
            .||::..:.|:|.:||.:.||| ..||||:..:.|:|:||:.||..||..||.|.||.|.:.:.:
 Frog   334 LPIVQNMVTALGCTWHPEHFCC-KVCKKPIGEEGFHEKDGEQYCSDDYFRLFGAVCAGCSEAVKE 397

  Fly   136 SAVLAMNVKWHRDCFRCNKCENPITSQTFTIDGDKPVC 173
            |.:.|:...||..||.|:.|..|..:.:|......|:|
 Frog   398 SYISALGGLWHPQCFVCHVCHTPFINGSFFEHEGLPLC 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31988NP_001286122.1 LIM 7..58 CDD:295319 24/50 (48%)
LIM 66..118 CDD:295319 22/51 (43%)
LIM 126..176 CDD:259829 15/48 (31%)
tgfb1i1XP_012825390.2 Paxillin <61..>117 CDD:397550
LIM1_Paxillin_like 270..322 CDD:259830 24/51 (47%)
LIM2_Paxillin_like 329..380 CDD:188723 22/51 (43%)
LIM3_Paxillin_like 388..440 CDD:188724 15/48 (31%)
LIM4_Paxillin_like 447..498 CDD:188725
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1593918at2759
OrthoFinder 1 1.000 - - FOG0000055
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X39
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.