DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31952 and LEA7

DIOPT Version :9

Sequence 1:NP_001285585.1 Gene:CG31952 / 326179 FlyBaseID:FBgn0051952 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_175678.1 Gene:LEA7 / 841701 AraportID:AT1G52690 Length:169 Species:Arabidopsis thaliana


Alignment Length:124 Identity:40/124 - (32%)
Similarity:55/124 - (44%) Gaps:0/124 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EGKKKAAEAAAAAKEAAASAAQAAKTKAAGAAGSAKEAAGAAASAAKDKAGAAAASAKEKAAGAA 67
            |.:.||.|....|........||||.|....|.||::.|...|.:||||...||.:.:|:|..:.
plant    13 ETRGKAQEKTGEAMGTMGDKTQAAKDKTQETAQSAQQKAHETAQSAKDKTSQAAQTTQERAQESK 77

  Fly    68 VAVQQSASSAAIAAREKAANAAEFTKEKATAAAAAATEAATSAASTVREKAAAAAVAVR 126
            .......|....|.:.||.:|||:|||.|.|.....:.........|::.|..|..||:
plant    78 DKTGSYMSETGEAIKNKAHDAAEYTKETAEAGKEKTSGILGQTGEQVKQMAMGATDAVK 136



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47372
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.