DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31952 and AT5G44310

DIOPT Version :9

Sequence 1:NP_001285585.1 Gene:CG31952 / 326179 FlyBaseID:FBgn0051952 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_199244.1 Gene:AT5G44310 / 834454 AraportID:AT5G44310 Length:331 Species:Arabidopsis thaliana


Alignment Length:213 Identity:60/213 - (28%)
Similarity:79/213 - (37%) Gaps:33/213 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDEGKKKAAEAAAAAKEAAASAAQAAKTKAAGAAGSAKEAAGAAASAAKDKAGAAAASAKEK--- 62
            ::||..:||:.|...||.|...|...|.|....|..||:.....||.|.|||......||:|   
plant   115 VNEGASRAADKAYETKEKAKDKAYDVKEKTKDYAEEAKDKVNEGASRAADKAYETKEKAKDKAYD 179

  Fly    63 --------AAGAAVAVQQSASSAAIAA---REKAANAAEFTKEKATAAAAAATEAATSA------ 110
                    |......|.:.||.||..|   :||..|.||.||:|....|:.|.:.|...      
plant   180 VKEKTKDFAEETKEKVNEGASRAADKAYDVKEKTKNYAEQTKDKVNEGASRAADKAEETKDKAKD 244

  Fly   111 -ASTVREKAAAAAVAVRAKASATAIAVRDSVTAVAVAAQGAAAAAKDKVATAAASAAAA------ 168
             |...:|||...|...:.||........|:|..|...|:..|....:.|..:...|..|      
plant   245 YAEDSKEKAEDMAHGFKEKAQDIGEKTMDTVKDVWETAKSTAQKVTEAVVGSGEEADKARDDVDK 309

  Fly   169 ------AKSKVTRQSQDE 180
                  .|:|..|...|:
plant   310 GLEDLSKKAKENRNKDDD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31952NP_001285585.1 None
AT5G44310NP_199244.1 Apolipoprotein 91..265 CDD:279749 47/149 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47372
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.