DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31937 and YMR226C

DIOPT Version :9

Sequence 1:NP_608616.2 Gene:CG31937 / 326177 FlyBaseID:FBgn0031360 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_013953.1 Gene:YMR226C / 855266 SGDID:S000004839 Length:267 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:84/262 - (32%)
Similarity:134/262 - (51%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QVVWITGASSGIGRALALSL--ARHG-VKLVLSARRLEQLEQVQEECLAAARGLLATKD------ 102
            :.|.|||||:|||:|.||..  |.:| :||:|:|||||:||::::           |.|      
Yeast    14 KTVLITGASAGIGKATALEYLEASNGDMKLILAARRLEKLEELKK-----------TIDQEFPNA 67

  Fly   103 -VLVIQMDMLDLDEHKTHLNTVLNHFHRLDVLVNNAGR---SQRASWTEVEIEVDRELFELDVFA 163
             |.|.|:|:...::.|..:..:...|..:|:||||||:   |.|..  ::..|..:::|:.:|.|
Yeast    68 KVHVAQLDITQAEKIKPFIENLPQEFKDIDILVNNAGKALGSDRVG--QIATEDIQDVFDTNVTA 130

  Fly   164 VVHLSRLVVRYFVEQNGGRGHIAATSSIAGFSPVPFSPTYCAAKHALNAYLLSLKVEM--RKLDV 226
            ::::::.|:..|..:|.  |.|....||||....|....|||:|.|:.|:..||:.|:  .|:.|
Yeast   131 LINITQAVLPIFQAKNS--GDIVNLGSIAGRDAYPTGSIYCASKFAVGAFTDSLRKELINTKIRV 193

  Fly   227 SLFAPGPIATDFLQEAFTGS--QGGKVGLSTANQKRMTAQRCGDLFAVALANKMDLTWCG--LFP 287
            .|.|||.:.|:|....:.|:  |...|...|.   .:.|....||...|.:.|.:.....  :||
Yeast   194 ILIAPGLVETEFSLVRYRGNEEQAKNVYKDTT---PLMADDVADLIVYATSRKQNTVIADTLIFP 255

  Fly   288 VN 289
            .|
Yeast   256 TN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31937NP_608616.2 NADB_Rossmann 44..293 CDD:304358 84/262 (32%)
adh_short 47..245 CDD:278532 72/212 (34%)
YMR226CNP_013953.1 SDR_c5 14..266 CDD:187604 84/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1205
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.